missing translation for 'onlineSavingsMsg'
Learn More

ALG10B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09561-100UL

Product Code. 18331676

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ALG10B Polyclonal specifically detects ALG10B in Human samples. It is validated for Western Blot.

Specifications

Antigen	ALG10B
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	KCR1
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of Human ALG10B (NP_001013642). Peptide sequence GFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFA
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	144245
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description