missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BMP-8b Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
459.00 EUR
Specifications
Antigen | BMP-8b |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
BMP-8b Polyclonal specifically detects BMP-8b in Human samples. It is validated for Western Blot.Specifications
BMP-8b | |
Western Blot | |
Unconjugated | |
Rabbit | |
Cytokine Research | |
PBS buffer, 2% sucrose | |
656 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
BMP-8, bone morphogenetic protein 8b, MGC131757 | |
The immunogen is a synthetic peptide directed towards the middle region of human BMP-8b (NP_001711.2). Peptide sequence VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title