missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEACAM20 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Bio-Techne NBP3-09600-100UL
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CEACAM20 Polyclonal specifically detects CEACAM20 in Human samples. It is validated for Western Blot.Spezifikation
CEACAM20 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Rabbit | |
Affinity purified | |
RUO | |
125931 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEACAM20. Peptide sequence VIAVASELGYFLCIRNARRPSRKTTEDPSHETSQPIPKEEHPTEPSSESL | |
100 μg | |
Primary | |
Human | |
Purified |