CEACAM20 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke: Bio-Techne NBP3-09600-100UL

Artikelnummer. 18331426

Please sign in to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

CEACAM20 Polyclonal specifically detects CEACAM20 in Human samples. It is validated for Western Blot.

Spezifikation

Antigen	CEACAM20
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	125931
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEACAM20. Peptide sequence VIAVASELGYFLCIRNARRPSRKTTEDPSHETSQPIPKEEHPTEPSSESL
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Produktvorschläge

Beschreibung