missing translation for 'onlineSavingsMsg'
Learn More

DBPA Antibody (1H5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00008531-M06

Product Code. 18331249

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DBPA Monoclonal antibody specifically detects DBPA in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	DBPA
Classification	Monoclonal
Conjugate	Unconjugated
Gene Accession No.	NP_003642
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Gene ID (Entrez)	8531
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG2a κ

Applications	Western Blot, ELISA, Immunocytochemistry
Clone	1H5
Formulation	In 1x PBS, pH 7.4
Gene Alias	cold shock domain protein A, Cold shock domain-containing protein A, cold-shock domain protein A, CSDA1, dbpA, DBPAcold-shock domain containing A1, DNA-binding protein A, Single-strand DNA-binding protein NF-GMB, ZO-1-associated nucleic acid-binding protein, ZONAB
Immunogen	CSDA (NP_003642, 241 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR
Quantity	0.1 mg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Description