missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
360.68 EUR - 575.58 EUR
Specifications
| Antigen | DDT |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18337965
|
Bio-Techne
NBP3-17653-25UL |
25 μg |
360.68 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18331314
|
Bio-Techne
NBP3-17653-100UL |
100 μg |
575.58 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DDT Polyclonal antibody specifically detects DDT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| DDT | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS, pH 7.2, 40% glycerol | |
| 1652 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| D-dopachrome decarboxylase, D-dopachrome tautomeraseDDCT, EC 4.1.1.84, Phenylpyruvate tautomerase II | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |