missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dematin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
360.68 EUR - 575.58 EUR
Specifications
| Antigen | Dematin |
|---|---|
| Dilution | Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18331316
|
Novus Biologicals
NBP3-17829-25UL |
25 μg |
360.68 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18383412
|
Bio-Techne
NBP3-17829-100UL |
100 μg |
575.58 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Dematin Polyclonal antibody specifically detects Dematin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Dematin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| dematin, DMTFLJ78462, Erythrocyte membrane protein band 4.9, erythrocyte membrane protein band 4.9 (dematin), FLJ98848 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 2039 | |
| IgG | |
| Affinity purified |