missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ GMPS Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-56670PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GMPS. Source: E.coli Amino Acid Sequence: AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT The GMPS Recombinant Protein Antigen is derived from E. coli. The GMPS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
8833 | |
GMPS Recombinant Protein Antigen | |
PBS and 1M Urea, pH 7.4. | |
EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein | |
Unlabeled | |
100μL | |
metabolism | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51515. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
GMPS | |
Recombinant Protein Antigen | |
RUO | |
E.coli |
For Research Use Only.