missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSE1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
360.68 EUR - 575.58 EUR
Specifications
| Antigen | GSE1 |
|---|---|
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18320847
|
Bio-Techne
NBP3-17501-25UL |
25 μg |
360.68 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18331335
|
Bio-Techne
NBP3-17501-100UL |
100 μg |
575.58 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GSE1 Polyclonal antibody specifically detects GSE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| GSE1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| KIAA0182 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VSLSEPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAPGGKKSLSMLHYIRG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 23199 | |
| IgG | |
| Affinity purified |