missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase IV (aa 173-286) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP90420
This item is not returnable.
View return policy
Description
Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary capillaries and proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Specifications
P22748 | |
Blocking Assay, Control | |
762 | |
100 μL | |
RUO | |
CA4 | |
Human | |
GTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGA | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Carbonic Anhydrase IV | |
-20° C, Avoid Freeze/Thaw Cycles | |
AW456718; CA IV; CA4; CAIV; CA-IV; Car4; Carbonate dehydratase IV; carbonic anhydrase 4; Carbonic anhydrase IV; carbonic dehydratase IV; RP17 | |
Unconjugated | |
Recombinant | |
E. coli |