missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase VB (aa 176-279) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP92233
This item is not returnable.
View return policy
Description
Carbonic anhydrases (CAs) are members of a large family of zinc metalloenzymes responsible for catalyzing the reversible hydration of carbon dioxide.CAs show extensive diversity in their distribution and subcellular localization.They are involved in a variety of biological processes, including calcification, bone resorption, respiration, acid-base balance and the formation of aqueous humor, saliva, gastric juice and cerebrospinal fluid. CA VB, also known as carbonate dehydratase VB, is one of two isoforms of CA V. It localizes to the mitochondria and is involved in metabolic processes. CA VB is predominantly expressed in heart, pancreas, lung, placenta, kidney and skeletal muscle. It exhibits highest homology with family member CA VA (the second isoform of CA V); however, unlike CA VA, it is not expressed in the liver, suggesting that it plays a significantly different physiological role.Specifications
Q9Y2D0 | |
Blocking Assay, Control | |
11238 | |
100 μL | |
RUO | |
CA5B | |
Human | |
GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Carbonic Anhydrase VB | |
-20° C, Avoid Freeze/Thaw Cycles | |
7330410H16Rik; Ca5b; Car5b; Carbonate dehydratase VB; carbonic anhydrase 5B; carbonic anhydrase 5b, mitochondrial; Carbonic anhydrase VB; carbonic anhydrase VB, mitochondrial; carbonic dehydratase; CarVb; CAVB; CA-VB; D730005F19Rik | |
Unconjugated | |
Recombinant | |
E. coli |