missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Carbonic Anhydrase VIII (aa 189-279) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP93924
This item is not returnable.
View return policy
Description
The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form.
Specifications
| P35219 | |
| Blocking Assay, Control | |
| 767 | |
| 100 μL | |
| RUO | |
| Ca8 | |
| Human | |
| IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| Carbonic Anhydrase VIII | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| AW546993; Ca8; Cals; Cals1; CAMRQ3; Car8; carbonate dehydratase; carbonic anhydrase 8; carbonic anhydrase VIII; carbonic anhydrase-like sequence; carbonic anhydrase-like sequence 1; carbonic anhydrase-related protein; CA-related protein; CARP; CA-RP; CARP VIII; CA-RP VIII; CA-VIII; hypothetical protein LOC550233; LOW QUALITY PROTEIN: carbonic anhydrase-related protein; MGC120502; MGC99509; wdl; zgc:110118 | |
| Unconjugated | |
| Recombinant | |
| E. coli |