missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Cathepsin L (aa 13-42) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP109208
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. At least two transcript variants encoding the same protein have been found for this gene.Especificaciones
P07711 | |
Blocking Assay, Control | |
1514 | |
100 μL | |
RUO | |
CTSL | |
Human | |
GIASATLTFDHSLEAQWTKWKAMHNRLYGM | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Cathepsin L | |
-20° C, Avoid Freeze/Thaw Cycles | |
1190035F06Rik; Cat L; cathepsin L; Cathepsin L1; Cathepsin L1 heavy chain; Cathepsin L1 light chain; CATHL; CatL; CP-2; Ctsl; CTSL1; cyclic protein 2; fs; furless; major excreted protein; MEP; nackt; nkt; p39 cysteine proteinase; Procathepsin L | |
Unconjugated | |
Recombinant | |
E. coli |