missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NLN (aa 22-89) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP95832
This item is not returnable.
View return policy
Description
This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.
Specifications
| Q9BYT8 | |
| Blocking Assay, Control | |
| 57486 | |
| 100 μL | |
| RUO | |
| Nln | |
| Human | |
| LRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCL | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| NLN | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 4930472G13Rik; AGTBP; angiotensin binding protein; angiotensin-binding protein; C79345; endopeptidase 24.16; EP24.16; KIAA1226; MEP; microsomal endopeptidase; Mitochondrial oligopeptidase M; MOP; neurolysin; neurolysin (metallopeptidase M3 family); neurolysin, mitochondrial; Neurotensin endopeptidase; NLN | |
| Unconjugated | |
| Recombinant | |
| E. coli |