missing translation for 'onlineSavingsMsg'
Learn More

KIF2C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17038-100UL

Product Code. 18331526

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

KIF2C Polyclonal antibody specifically detects KIF2C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	KIF2C
Classification	Polyclonal
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias	kinesin family member 2C, kinesin-like 6 (mitotic centromere-associated kinesin), Kinesin-like protein 6, kinesin-like protein KIF2C, MCAKKNSL6kinesin-like 6, Mitotic centromere-associated kinesin
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: MDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQK
Quantity	100 μg
Research Discipline	Cancer, Cell Biology, Cellular Markers, DNA Repair
Gene ID (Entrez)	11004
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Description