missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ NANS Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP1-87088PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NANS. The NANS Recombinant Protein Antigen is derived from E. coli. The NANS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-87088. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifications
54187 | |
Chromatography | |
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
NANS | |
26kDa | |
0.1mL | |
metabolism, Signal Transduction | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87088. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Human | |
>80% | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unlabeled | |
NANS | |
RUO | |
E.Coli | |
LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction