missing translation for 'onlineSavingsMsg'
Learn More

OSAP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17084-100UL

Product Code. 18331807

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

OSAP Polyclonal antibody specifically detects OSAP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	OSAP
Classification	Polyclonal
Dilution	Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias	chromosome 4 open reading frame 49, hypoxia up-regulated mitochondrial movement regulator, MGC125827, MGC125828, OSAP
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: ARETTEVNPETTPEVTNAALDEAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEAASAQG
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	84709
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description