missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PWP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 EUR
Specifications
| Antigen | PWP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Descripción
PWP1 Polyclonal specifically detects PWP1 in Human samples. It is validated for Western Blot.Especificaciones
| PWP1 | |
| Polyclonal | |
| Rabbit | |
| NP_008993 | |
| 11137 | |
| Synthetic peptide directed towards the C terminal of human PWP1The immunogen for this antibody is PWP1. Peptide sequence FCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| IEF-SSP-9502, Keratinocyte protein IEF SSP 9502, nuclear phosphoprotein similar to S. cerevisiae PWP1, periodic tryptophan protein 1 homolog, PWP1 homolog (S. cerevisiae) | |
| PWP1 | |
| IgG |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto