missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein
A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.
405.00 EUR - 2365.00 EUR
Specifications
Name | Hepatitis C HCV NS4 a+b Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Hepatitis C |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15939608
|
enQuireBio™
QP12178-B-100ug |
100 μg |
405.00 EUR
100µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
15959608
|
enQuireBio™
QP12178-B-500ug |
500 μg |
1420.00 EUR
500µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
15949608
|
enQuireBio™
QP12178-B-1mg |
1 mg |
2365.00 EUR
1mg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Specifications
Hepatitis C HCV NS4 a+b Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Hepatitis C | |
Biotin | |
(1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863 | |
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining). |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title