missing translation for 'onlineSavingsMsg'
Learn More

SIRPB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09533-100UL

Product Code. 18331697

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

SIRPB2 Polyclonal specifically detects SIRPB2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SIRPB2
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	dJ776F14.2, Protein Tyrosine Phosphatase Non-Receptor Type Substrate 1-Like 3, Protein Tyrosine Phosphatase Non-Receptor Type Substrate Protein, Protein Tyrosine Phosphatase, Non-Receptor Type 1-Like, Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1-Like 3, PTPN1L, PTPNS1L3, Signal-Regulatory Protein Beta 2, Signal-Regulatory Protein Beta-2, SIRP-beta-2, SIRPG
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIRPB2 (NP_001128308). Peptide sequence VSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPAT
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	284759
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description