missing translation for 'onlineSavingsMsg'
Learn More

TMEM105 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09895-100UL

Product Code. 18331225

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

TMEM105 Polyclonal specifically detects TMEM105 in Human samples. It is validated for Western Blot.

Specifications

Antigen	TMEM105
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	284186
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEM105 (NP_848615). Peptide sequence IGQLIYLLTWSLFTAWLRPPTLLQGPRTSPQGSPPRSPWGDCAEPSCLCE
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Description