missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACTH Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Brand: Thermo Scientific PA595177
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL.
ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.
Specifications
| ACTH | |
| Polyclonal | |
| Unconjugated | |
| Pomc | |
| ACTH, adrenal corticotropic hormone, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte stimulating hormone, alpha-melanocyte-stimulating hormone, alphaMSH, alpha-MSH, BE, beta-endorphin, Beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, Clip, Corticotropin, Corticotropin-like intermediary peptide, corticotropin-lipotropin, Gamma-LPH, gamma-MSH, Lipotropin beta, lipotropin gamma, LPH, Melanocyte-stimulating hormone alpha, Melanocyte-stimulating hormone beta, Melanotropin alpha, melanotropin beta, Melanotropin gamma, met-enkephalin, MSH, NPP, opiomelanocortin prepropeptide, OTTHUMP00000119991, OTTHUMP00000200964, POC, Pomc, Pomc1, Pomc-1, Pomc2, Potential peptide, Precursor of MSH, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin), proopiomelanocortin preproprotein, proopiomelanocortin, beta (endorphin, beta), pro-opiomelanocortin-alpha, proopoimelanocortin, beta (endorphin, beta) | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 18976, 24664, 5443 | |
| Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. | |
| Lyophilized |
| Immunohistochemistry (Paraffin) | |
| 500 μg/mL | |
| PBS with 5MG BSA and 0.05MG sodium azide | |
| P01189, P01193, P01194 | |
| Pomc | |
| A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Suggestions
Customers who viewed this item also viewed.
Viewing 1-4 of
-
Catalog No. 10399053
141,00 € / Pack of 50 -
Catalog No. 10125092
922,00 € / 300 units -
Catalog No. 10678484
205,00 € / 500mL -
Catalog No. 13464189
105,00 € / Pack of 5 -
Catalog No. 10647894
280,00 € / 250mL -
Catalog No. 10116287
187,00 € / 1mL -
Catalog No. 17821163
Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech
226,00 € / 100µg -
Catalog No. 11570806
656,00 € / 5mg -
Catalog No. 17833373
Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech
87,25 € / 100µg -
Catalog No. 15137105
9.870,00 € / Each -
Catalog No. 10347642
345,00 € / Each -
Catalog No. 11514270
862,00 € / 100µL
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
ACTH Polyclonal Antibody, Invitrogen™ > 100 μg; Unconjugated
Spot an opportunity for improvement?Share a Content Correction
.tif-150.jpg)