missing translation for 'onlineSavingsMsg'
Learn More

glutamate-ammonia ligase (glutamine synthetase), Mouse, Clone: 3B6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GLUL.

Brand: Abnova H00002752-M02.100ug

Product Code. 16118754

335.00 EUR / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]).[supplied by OMIM

Sequence: IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Specifications

Antigen	glutamate-ammonia ligase (glutamine synthetase)
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_002065
Gene Symbols	GLUL
Immunogen	GLUL (NP_002056, 274 a.a. ∼ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Whole Molecule	Yes
Gene ID (Entrez)	2752
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG1 κ

Applications	ELISA, Western Blot
Clone	3B6
Description	Mouse monoclonal antibody raised against a partial recombinant GLUL.
Gene	GLUL
Gene Alias	GLNS/GS/PIG43/PIG59
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10399053

Invitrogen ™ Countess ™ Cell Counting Chamber Invitrogen ™ Countess ™ Cell Counting Chamber

141,00 € / Pack of 50
Catalog No. 10125092

Invitrogen ™ Phalloidin Labeling Probes Invitrogen ™ Phalloidin Labeling Probes

922,00 € / 300 units
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

105,00 € / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

280,00 € / 250mL
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

187,00 € / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

656,00 € / 5mg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100µg
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR System, 96 Applied Biosystems ™ ProFlex ™ PCR System, 96

9.870,00 € / Each
Catalog No. 10347642

Invitrogen V5 Tag Monoclonal Antibody (SV5-Pk1) Invitrogen V5 Tag Monoclonal Antibody (SV5-Pk1)

345,00 € / Each
Catalog No. 11514270

Invitrogen Trenbolone Polyclonal Antibody, Invi Invitrogen Trenbolone Polyclonal Antibody, Invi

862,00 € / 100µL

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

glutamate-ammonia ligase (glutamine synthetase), Mouse, Clone: 3B6, Abnova™ > 100μg; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

glutamate-ammonia ligase (glutamine synthetase), Mouse, Clone: 3B6, Abnova™

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show