missing translation for 'onlineSavingsMsg'
Learn More

GPR160 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-09485-100UL

Product Code. 18331255

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

GPR160 Polyclonal specifically detects GPR160 in Human samples. It is validated for Western Blot.

Specifications

Antigen	GPR160
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	G protein-coupled receptor 160, GPCR150GPCR1, G-protein coupled receptor GPCR1, hGPCR1, probable G-protein coupled receptor 160, putative G protein-coupled receptor
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR160 (NP_055188). Peptide sequence FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM
Quantity	100 μg
Research Discipline	GPCR
Gene ID (Entrez)	26996
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description