missing translation for 'onlineSavingsMsg'
Learn More

Print

GPR160 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

449.23 EUR

Specifications

Antigen	GPR160
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18331255 View Documents Promotion Details missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-09485-100UL	100 μg	449.23 EUR 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Description

GPR160 Polyclonal specifically detects GPR160 in Human samples. It is validated for Western Blot.

Specifications

Specifications

Antigen	GPR160
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	GPCR
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	26996
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	G protein-coupled receptor 160, GPCR150GPCR1, G-protein coupled receptor GPCR1, hGPCR1, probable G-protein coupled receptor 160, putative G protein-coupled receptor
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR160 (NP_055188). Peptide sequence FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM
Purification Method	Affinity purified

Back to Top