Learn More
Invitrogen™ Human ARHGEF11 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP89158
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52776 (PA5-52776. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ARHGEF11 is a 1527 amino acid protein with tandem dbl homology and pleckstrin homology domains, PDZ domain, two proline rich sequences and a regulatory G protein-signaling (RGS) sequence. It acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase, but not for RAC1 or CDC42 and acts as GTPase-activating protein (GAP) for GNA12 and GNA13. It forms a complex with G proteins and stimulates neurite through retraction Rho-dependent signals. ARHGEF11 increases glutamate transport 4-fold. It interacts with EAAT4 and modulates its uptake activity and perisynaptic distribution at glutamatergic synapses. It is known to induce the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. It is ubiquitously expressed, in brain, lung, liver, kidney and skeletal muscle.
Specifications
O15085 | |
Blocking Assay, Control | |
9826 | |
100 μL | |
Arhgef11; B930073M02; E130307F09; glutamate transporter EAAT4 associated protein 48; glutamate transporter EAAT4-associated protein 48; Gtrap48; KIAA0380; mKIAA0380; PDZ-RhoGEF; Prg; Rho guanine exchange factor (GEF) 11; Rho guanine nucleotide exchange factor (GEF) 11; rho guanine nucleotide exchange factor 11; RhoA-specific guanine nucleotide exchange factor; RhoGEF; RhoGEF glutamate transport modulator; RhoGEF glutamate transport modulator GTRAP48; RP11-356J7.2 | |
ARHGEF11 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ARHGEF11 Control Fragment | |
RUO | |
ARHGEF11 | |
Unconjugated | |
Recombinant | |
LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.