missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C19orf53 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP106973
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66292 (PA5-66292. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May have a potential role in hypercalcemia of malignancy.
Specifications
| Q9UNZ5 | |
| Blocking Assay, Control | |
| 28974 | |
| 100 μL | |
| C19orf53; chromosome 19 open reading frame 53; HSPC023; Leydig cell tumor 10 kDa protein homolog; LYDG10 | |
| C19orf53 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C19orf53 Control Fragment | |
| RUO | |
| C19orf53 | |
| Unconjugated | |
| Recombinant | |
| GQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPRKARVVQQQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human C19orf53 Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction
