missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GCC2 Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP96085

Product Code. 30212715

265.00 EUR / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57428 (PA5-57428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a peripheral membrane protein localized to the trans-Golgi network. It is sensitive to brefeldin A. This encoded protein contains a GRIP domain which is thought to be used in targeting. Alternative splicing results in multiple transcript variants.

Specifications

Accession Number	Q8IWJ2
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	9648
Quantity	100 μL
Gene Alias	0610043A03Rik; 185 kDa Golgi coiled-coil protein; 2210420P05Rik; 2600014C01Rik; AW112121; CLL-associated antigen KW-11; CTCL tumor antigen se1-1; GCC protein, 185-kD; GCC185; GCC2; Golgi coiled-coil protein GCC185; GRIP and coiled-coil domain containing 2; GRIP and coiled-coil domain-containing protein 2; KIAA0336; mKIAA0336; Ran-binding protein 2-like 4; RanBP2L4; REN53; Renal carcinoma antigen NY-REN-53
Gene Symbol	GCC2
Species	Human
Protein Tag	His-ABP-tag
Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1 M urea, PBS with no preservative; pH 7.4
Name	Human GCC2 Control Fragment
Regulatory Status	RUO
Common Name	GCC2
Conjugate	Unconjugated
Recombinant	Recombinant
Sequence	QNISEANSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELENLRKATSNANQDNQICSIL
Expression System	E. coli
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 11

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

105,00 € / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

280,00 € / 250mL
Catalog No. 11560626

Gibco ™ Trypsin-EDTA (0.25%), phenol red Gibco ™ Trypsin-EDTA (0.25%), phenol red

23,01 € / 100mL
Catalog No. 11580626

Gibco ™ Trypsin-EDTA (0.05%), phenol red Gibco ™ Trypsin-EDTA (0.05%), phenol red

24,70 € / 100mL
Catalog No. 11548876

Gibco ™ Penicillin-Streptomycin (10,000 U/mL) Gibco ™ Penicillin-Streptomycin (10,000 U/mL)

27,37 € / 100mL
Catalog No. 10729174

Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross- Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross-

311,00 € / 500µL
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR System, 96 Applied Biosystems ™ ProFlex ™ PCR System, 96

9.870,00 € / Each
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100µL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100µg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100µg

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Invitrogen™ Human GCC2 Control Fragment Recombinant Protein > 100 μL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Invitrogen™ Human GCC2 Control Fragment Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show