Learn More
Invitrogen™ Human GFAP (aa 370-430) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP101660
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GFAP (Glial fibrillary acidic protein) is a member of the class III intermediate filament protein family. GFAP is heavily and specifically expressed in astrocytes and certain astroglia of the central nervous system, in satellite cells of peripheral ganglia, and in non-myelinating Schwann cells of peripheral nerves. In addition, neural stem cells strongly express GFAP. Antibodies to GFAP are very useful as markers of astrocytic cells. In addition, many types of brain tumor, presumably derived from astrocytic cells, heavily express GFAP. GFAP is also found in the lens epithelium, Kupffer cells of the liver, in some cells in salivary tumors and has been reported in erythrocytes. GFAP is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing of the GFAP gene results in multiple transcript variants encoding distinct isoforms.
Specifications
P14136 | |
Blocking Assay, Control | |
2670 | |
100 μL | |
6330404F12Rik; 65 kDa glutamic acid decarboxylase; AI836096; ALXDRD; Astrocyte or Intermediate Filament Protein; cb345; class III intermediate filament protein; etID36982.3; FLJ45472; GAD(65); Gad2; Gad-2; GAD65; GAD-65; GFAP; GFAP epsilon; gfap protein; gfapl; glial fibrillary acidic protein; Glial Fibrillary Acidic Protein (GFAP); glial fibrillary acidic protein alpha; glutamate decarboxylase 2; Glutamate decarboxylase 65 kDa isoform; glutamic acid decarboxylase 2; I79_011607; intermediate filament; intermediate filament protein; intermediate filament protein; GFAP; Unknown (protein for MGC:139638); wu:fb34h11; wu:fk42c12; xx:af506734; zgc:110485; zGFAP; intermediate filament protein; zrf-1 antigen | |
GFAP | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GFAP (aa 370-430) Control Fragment | |
RUO | |
GFAP | |
Unconjugated | |
Recombinant | |
LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.