Learn More
Invitrogen™ Human Serine racemase (aa 173-272) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP105710
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64916 (PA5-64916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SRR (serine racemase) catalyzes the synthesis of D-serine from L-serine.
Specifications
Q9GZT4 | |
Blocking Assay, Control | |
63826 | |
100 μL | |
D-serine ammonia-lyase; D-serine dehydratase; ILV1; ISO1; L-serine ammonia-lyase; L-serine dehydratase; Serine racemase; SRR; Srs | |
Srr | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Serine racemase (aa 173-272) Control Fragment | |
RUO | |
Serine racemase | |
Unconjugated | |
Recombinant | |
QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.