Learn More
Invitrogen™ Human VSIG8 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP106322
Description
Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84045 (PA5-84045. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.
Specifications
P0DPA2 | |
Blocking Assay, Control | |
391123 | |
100 μL | |
A030011M19; C1orf204; EG240916; LOC100727929; LOW QUALITY PROTEIN: V-set and immunoglobulin domain-containing protein 8; RGD1562464; V-set and immunoglobulin domain containing 8; V-set and immunoglobulin domain containing 8; V-set and immunoglobulin domain-containing protein 8; V-set and immunoglobulin domain-containing protein 8; Vsig8 | |
VSIG8 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human VSIG8 Control Fragment | |
RUO | |
VSIG8 | |
Unconjugated | |
Recombinant | |
SGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Product Suggestions
Customers who viewed this item also viewed
Your input is important to us. Please complete this form to provide feedback related to the content on this product.