missing translation for 'onlineSavingsMsg'
Learn More

KCTD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17507-100UL

Product Code. 18331735

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

KCTD1 Polyclonal antibody specifically detects KCTD1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	KCTD1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	BTB/POZ domain-containing protein KCTD1, C18orf5, potassium channel tetramerisation domain containing 1
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	284252
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description