missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCTD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
360.68 EUR - 575.58 EUR
Specifications
| Antigen | KCTD1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18391885
|
Bio-Techne
NBP3-17507-25UL |
25 μg |
360.68 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18331735
|
Bio-Techne
NBP3-17507-100UL |
100 μg |
575.58 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KCTD1 Polyclonal antibody specifically detects KCTD1 in Human samples. It is validated for ImmunofluorescenceSpecifications
| KCTD1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| BTB/POZ domain-containing protein KCTD1, C18orf5, potassium channel tetramerisation domain containing 1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 284252 | |
| IgG | |
| Affinity purified |