missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCTD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17507-100UL
This item is not returnable.
View return policy
Description
KCTD1 Polyclonal antibody specifically detects KCTD1 in Human samples. It is validated for ImmunofluorescenceSpecifications
KCTD1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
BTB/POZ domain-containing protein KCTD1, C18orf5, potassium channel tetramerisation domain containing 1 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT | |
100 μg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
284252 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |