missing translation for 'onlineSavingsMsg'
Learn More

NFATC3/NFAT4 Antibody (3A12), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00004775-M02

Product Code. 18360198

597.00 EUR / 0.01mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

NFATC3/NFAT4 Monoclonal antibody specifically detects NFATC3/NFAT4 in Human samples. It is validated for ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen	NFATC3/NFAT4
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	In 1x PBS, pH 7.4
Gene Alias	NF-AT4, NFAT4nuclear factor of activated T-cells, cytoplasmic 3, NFATc3, NF-ATc3, NFATx, nuclear factor of activated T-cells c3 isoform IE-Xa, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3, T cell transcription factor NFAT4, T-cell transcription factor NFAT4
Immunogen	NFATC3 (NP_775188, 70 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
Quantity	0.1 mg
Research Discipline	Wnt Signaling Pathway
Gene ID (Entrez)	4775
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG2b κ

Applications	ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Clone	3A12
Dilution	ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.	NP_775188
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10399053

Invitrogen ™ Countess ™ Cell Counting Chamber Invitrogen ™ Countess ™ Cell Counting Chamber

141,00 € / Pack of 50
Catalog No. 10125092

Invitrogen ™ Phalloidin Labeling Probes Invitrogen ™ Phalloidin Labeling Probes

922,00 € / 300 units
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

105,00 € / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

280,00 € / 250mL
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

187,00 € / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

656,00 € / 5mg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100µg
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR System, 96 Applied Biosystems ™ ProFlex ™ PCR System, 96

9.870,00 € / Each
Catalog No. 10347642

V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge

345,00 € / Each
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100µL

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

NFATC3/NFAT4 Antibody (3A12), Novus Biologicals™ > 0.1 mg, Unconjugated

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

NFATC3/NFAT4 Antibody (3A12), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show