missing translation for 'onlineSavingsMsg'
Learn More

PLA2G12B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP2-31685

View more versions of this product

Product Code. 18106902

515.00 EUR / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PLA2G12B Polyclonal specifically detects PLA2G12B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	PLA2G12B
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.	Q9BX93
Gene Symbols	PLA2G12B
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: DTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESM
Quantity	0.1 mL
Research Discipline	Lipid and Metabolism
Gene ID (Entrez)	84647
Target Species	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	group XIIB secretory phospholipase A2-like protein, group XIII secreted phospholipase A2, Group XIII secretory phospholipase A2-like protein, GXIIBMGC138151, GXIII sPLA2-like, GXIIIsPLA2, phospholipase A2, group XIIB, phospholipase A2, group XIII, PLA2G13, sPLA2-GXIIB
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Customers who viewed this item also viewed This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 12

Catalog No. 10125092

Invitrogen ™ Phalloidin Labeling Probes Invitrogen ™ Phalloidin Labeling Probes

922,00 € / 300 units
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 10671531

Thermo Scientific ™ 3000 Series Nanosphere ™ Thermo Scientific ™ 3000 Series Nanosphere ™

703,00 € / 15mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

105,00 € / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

280,00 € / 250mL
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

187,00 € / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

656,00 € / 5mg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100µg
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR System, 96 Applied Biosystems ™ ProFlex ™ PCR System, 96

9.870,00 € / Each
Catalog No. 10347642

V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge

345,00 € / Each
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100µL

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

PLA2G12B Antibody, Novus Biologicals™ > 0.1mL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

PLA2G12B Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Special Offers

You recently viewed...Show