missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HPV HPV 6 Protein
A cDNA sequence encoding the HPV 6 was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12309-1mg
This item is not returnable.
View return policy
Specifications
HPV HPV 6 Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK | |
Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HPV | |
GST | |
PBS and 3M Urea. |