missing translation for 'onlineSavingsMsg'
Learn More

Print

enQuireBio™ Recombinant HPV HPV 6 Protein

A cDNA sequence encoding the HPV 6 was constructed and used to recombinantly synthesize the protein.

Specifications

Name	HPV HPV 6 Protein
Regulatory Status	Research Use Only
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type	Recombinant Protein
Cross Reactivity	HPV

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
15950009 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP12309-100ug	100 μg	N/A View alternative products Save Up to »	N/A

15970009 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP12309-500ug	500 μg	N/A View alternative products Save Up to »	N/A

15960009 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP12309-1mg	1 mg	N/A View alternative products Save Up to »	N/A

Specifications

Specifications

Name	HPV HPV 6 Protein
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	HPV
Protein Tag	GST
Buffer	PBS and 3M Urea.

Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	E. coli
Sequence	VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK
Purity or Quality Grade	Protein is >95% pure as determined by 10% PAGE (coomassie staining).

Back to Top