missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein

A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.

Brand: enQuireBio™ QP11985-1mg

Product Code. 15949008

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Specifications

Name	Gliadin Gamma Wheat Protein
Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	E. coli
Sequence	MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
Purity or Quality Grade	Protein is >90% pure.

Quantity	1 mg
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	Other
Protein Tag	His
Buffer	Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2.

Product Suggestions

Description