missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein
A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.
208.00 EUR - 1595.00 EUR
Specifications
Name | Gliadin Gamma Wheat Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Other |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15939008
|
enQuireBio™
QP11985-100ug |
100 μg |
208.00 EUR
100µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
15959008
|
enQuireBio™
QP11985-500ug |
500 μg |
795.00 EUR
500µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
15949008
|
enQuireBio™
QP11985-1mg |
1 mg |
1595.00 EUR
1mg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Specifications
Gliadin Gamma Wheat Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Other | |
His | |
Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH | |
Protein is >90% pure. |