missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL35A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10041-25UL
This item is not returnable.
View return policy
Description
RPL35A Polyclonal specifically detects RPL35A in Human samples. It is validated for Western Blot.Specifications
RPL35A | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Cell growth-inhibiting gene 33 protein, DBA5,60S ribosomal protein L35a, ribosomal protein L35a | |
The immunogen is a synthetic peptide directed towards the middle region of human RPL35A (NP_000987.2). Peptide sequence LKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRA | |
25 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
6165 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |