missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL35A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
191.14 EUR - 449.23 EUR
Specifications
| Antigen | RPL35A |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18331575
|
Bio-Techne
NBP3-10041-25UL |
25 μg |
191.14 EUR
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18354005
|
Bio-Techne
NBP3-10041-100UL |
100 μg |
449.23 EUR
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPL35A Polyclonal specifically detects RPL35A in Human samples. It is validated for Western Blot.Specifications
| RPL35A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Cell growth-inhibiting gene 33 protein, DBA5,60S ribosomal protein L35a, ribosomal protein L35a | |
| The immunogen is a synthetic peptide directed towards the middle region of human RPL35A (NP_000987.2). Peptide sequence LKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRA | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 6165 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |