missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SERINC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13296
This item is not returnable.
View return policy
Description
SERINC3 Polyclonal specifically detects SERINC3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SERINC3 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| AIGP1, DIFF33tumor differentially expressed 1, placental transmembrane protein (mouse testicular tumor differentiallyexpressed), SBBI99, serine incorporator 3, TDE, TDE1Tumor differentially expressed protein 1, TMS-1, transmembrane protein SBBI99, tumour differentially expressed 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 10955 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SERINC3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
SERINC3 Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction