missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TROP2 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104102
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84235 (PA5-84235. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TROP2 is a carcinoma-associated antigen defined by the monoclonal antibody GA733. This antigen is a member of a family including at least two type I membrane proteins. It transduces an intracellular calcium signal and acts as a cell surface receptor. Mutations of its gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness.
Specifications
| P09758 | |
| Blocking Assay, Control | |
| 4070 | |
| 100 μL | |
| 40 kD glycoprotein, identified by monoclonal antibody GA733; C80403; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; EGP1; EGP-1; epithelial glycoprotein-1; GA733; GA7331; GA733-1; gastrointestinal tumor-associated antigen GA7331; GP50; Ly97; lymphocyte antigen 97; M1S1; Membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker protein GA733-1; parturition-related protein 1; Prp1; TACD2; TACSTD2; Trop2; truncated TACSTD2; tumor-associated calcium signal transducer 2; tunor-associated calcium signal transducer 2 | |
| TACSTD2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TROP2 Control Fragment | |
| RUO | |
| TROP2 | |
| Unconjugated | |
| Recombinant | |
| AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human TROP2 Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction
