Learn More
Invitrogen™ Human CPS1 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP102361
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82760 (PA5-82760. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation.
Specifications
P31327 | |
Blocking Assay, Control | |
1373 | |
100 μL | |
4732433M03Rik; carbamoyl-phosphate synthase (ammonia); carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoyl-phosphate synthase 1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl-phosphate synthetase 1; carbamoyl-phosphate synthetase 1, mitochondrial; carbamoylphosphate synthetase I; carbamoyl-phosphate synthetase I; carbamyl phosphate synthetase I; carboamyl-phosphate synthetase 1; cps; CPS1; CPSase I; CPSASE1; CPSI; D1Ucla3; PHN | |
CPS1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CPS1 Control Fragment | |
RUO | |
CPS1 | |
Unconjugated | |
Recombinant | |
FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.